PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof014133
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 212aa    MW: 24237.5 Da    PI: 9.6762
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-87761PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-174892248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     gr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
        Sof014133 48 GRMSPHEERLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 92
                     89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-92754IPR009057Homeodomain-like
PROSITE profilePS500904.4262741IPR017877Myb-like domain
SuperFamilySSF466894.08E-2227101IPR009057Homeodomain-like
PROSITE profilePS5129425.3024296IPR017930Myb domain
SMARTSM007174.2E-164694IPR001005SANT/Myb domain
PfamPF002495.7E-154891IPR001005SANT/Myb domain
CDDcd001673.10E-124992No hitNo description
Gene3DG3DSA:1.10.10.603.3E-205593IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
XKVANINVFL SNQPSSYYVL YVHAGLNRTG KSCRLRWVNY LHPGLKHGRM SPHEERLIIE  60
LHARWGNRWS RIARRLPGRT DNEIKNYWRT HMRKKAQERK MSMSSPSSSS SSLTYQACLL  120
DTVPVTGMGS ADTHNGSCVT SALENTQSAM DGYPMDQIWK AIEAPQAPAL LGIAERKEKT  180
CSSIPCHLPS PAMWDYKYSE VFWKKEDQEI MM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-18149624105MYB PROTO-ONCOGENE PROTEIN
1msf_C2e-18149624105C-Myb DNA-Binding Domain
1mse_C2e-18149624105C-Myb DNA-Binding Domain
1h89_C4e-18149678159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-18149678159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.90650.0seed
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149882.11e-119MYB59
SwissprotQ53NK61e-93MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLC3S3G11e-123C3S3G1_SACOF; MYB transcription factor MYBAS1
TrEMBLF2W4031e-123F2W403_9POAL; MYB transcription factor
STRINGGRMZM2G048136_P021e-117(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.22e-48myb domain protein 59